PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01002169G0420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 216aa    MW: 22809 Da    PI: 9.8562
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01002169G0420genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC811.1e-25133177145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+
  PH01002169G0420 133 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVEA 177
                      69****************************************997 PP

2QLQ477.7e-1768103237
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                       +T +Q q+L++Q+l+y+y+a ++PvP +L+++i+k
  PH01002169G0420  68 GLTFMQQQELEHQVLIYRYFAVGAPVPVHLVLPIWK 103
                      5899*******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-467103IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.85768103IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.3E-970102IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.701133177IPR014977WRC domain
PfamPF088793.0E-21134176IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MAEEKEADSP QPPSKLPRLS CADPNAGAVT MAASSPLVLG LGLGLGGNSC SERGVEAPAA  60
HKATAPSGLT FMQQQELEHQ VLIYRYFAVG APVPVHLVLP IWKSVAASSF GPHRFPSLMG  120
LGSLCFDYRS SMEPEPGRCR RTDGKKWRCS RDVVPGHKYC ERHVHRGRGR SRKPVEASAA  180
TTPAPNGGGS SISASPRGLG FSPTSVLLAH STARAT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0997370.0FP099737.1 Phyllostachys edulis cDNA clone: bphyst023e19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624932.11e-110PREDICTED: growth-regulating factor 10 isoform X2
SwissprotQ6EPP91e-110GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLA0A0E0K3L71e-113A0A0E0K3L7_ORYPU; Uncharacterized protein
STRINGBGIOSGA008811-PA1e-108(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62213051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.19e-38growth-regulating factor 3